HN Explorer

16 comments

[ 4.2 ms ] story [ 42.0 ms ] thread
DonHopkins
>New Protein Therapy Shows Promise as Antidote for Carbon Monoxide Poisoning

So Shatner was right all along: not only is Promise Margarine good for lowering your cholesterol level, but it can also treat carbon monoxide poisoning! And it tastes like butter, promise.

https://www.youtube.com/watch?v=n3wf717fKFE

[dead] narrator
[flagged]
Herodotus38
Hello, I would be interested if you could give evidence that methylene blue "works great" for carbon monoxide poisoning in humans.

It is not the standard of care in any guidelines I can find from any country. There is a paper from 2018 out of china showing some benefit in a rat model: https://onlinelibrary.wiley.com/doi/10.1111/bcpt.12940

skadamou
Methylene blue is actually used to treat acquired cases of a similar condition called methemeglobinemia which is when the iron in heme is oxide from Fe2+ to Fe3+ [1]. This is different from carbon monoxide poisoning which is caused by carbon monoxide binding more tightly to hemoglobin than oxygen preventing oxygen from effectively getting into your blood.

[1] https://www.uptodate.com/contents/methemoglobinemia?search=m...

bananapub
not very on topic, but for those who missed one of the more surreal reddit threads in history:

- [MA] Post-it notes left in apartment [0]

- and the update from OP a while later [1]

[0]: https://www.reddit.com/r/legaladvice/comments/34l7vo/ma_post...

[1]: https://www.reddit.com/r/AskReddit/comments/49zfvb/what_is_t...

gus_massa
It looks like he found a note in his room and see some strange thing in the window, and someone somehow says it's CO but it may be that the OP has unrelated hallucinations. Is this a symptom of CO poisoning? I think you only get sleepy, faint and die.
dtgriscom
How is this administered? Seems like a crucial detail to omit.
searine
This research was funded by multiple NIH grants, a Department of Defense grant, and the Martin Family Foundation.
jfarlow
Here's the full sequence of the protein, found in the supplement [1]

KSSEPASVSAAERRAETEQHKLEQENPGIVWLDQHGRVTAENDVALQILGPAGEQSLGVAQDSLEGIDVVQLHPEKSRDKLRFLLQSKDVGGSPVKSPPPVAMMINIPDRILMIKVSSMIAAGGASGTSMIFYDVTDLTTEPSGLPAGGSAPSHHHHHH

It is a protein encoding the PxRcoM-1 heme binding domain with C94S mutation and a C-terminal 6xHis tag (RcoM-HBD-C94S)

[1] https://www.pnas.org/doi/10.1073/pnas.2501389122#supplementa...

[deleted]
(comment deleted)
hinkley
> Infused in the bloodstream, scavenger hemoproteins like RcoM-HBD-CCC rapidly bind to carbon monoxide molecules, reducing the time it takes to clear half of the carbon monoxide in the blood to less than a minute, compared to more than hour with pure oxygen therapy and five hours without any treatment.
sandworm101
CO poisioning is one of those strange cases treatable using scuba diving. Recompression therapy, which can be theoretically aped under water, can be like magic. In some cases the patient just wakes up like nothing is wrong. No drugs. No invasive treatment. Get deep enough and hemoglobin isnt totally necessary for getting O2 where it needs to be.

https://www.ncbi.nlm.nih.gov/books/NBK470531/

pfdietz
This looks like a therapy you can only get once in your life, after which it has acted like a vaccine and your immune system would react to it.
PaulHoule
I guess CO kills you because it sticks to a protein (Hemoglobin), this is a protein that it binds even tighter to.

What I find hilarious though is that my RSS reader loves to show me articles about ways of turning the harmful gas CO2 into the useful gas CO, back when I was a kid it was the other way around!