37 comments

[ 3.3 ms ] story [ 65.6 ms ] thread
This might in general be a good preprocessing step to check for punctuation repeating in fixed intervals and remove it, and restore after decompression.
Yes, it sounds like 7-Zip/LZMA can do this using custom filters, among other more exotic (and slow) statistical compression approaches.
That turns in into specialized compression, which DNA already has plenty of. Many forms of specialized compression even allow string-related queries directly on the compressed data.
There are plenty of data formats where data is interspersed with fixed delimiters in fixed intervals.
In fixed intervals? I'm not so sure about that. Generally if the intervals are fixed, you shouldn't need delimiters, you know where one thing begins and another ends anyway.

Anyway, BWT-based compressors like Bzip2 do a good job on "repetition, but with random differences". Better than LZ-based compressors. However, they are not competitive on speed, and it's gotten relatively worse as computers got faster since the Burrows-Wheeler transform can't be parallelized very well and is inherently cache-unfriendly.

All kinds of data - block justified text, database files with fixed row size tables, even HTTP chunked encoding tends to have blocks of same size with same delimiters,...

I really don't see how better supporting this "second order repetition" feature in the encoding would cause such a big problem. LZ variants already track repeating strings.

Now I'm wondering why this works. DNA clearly has some interesting redundancy strategies. (it might also depend on genome?)
What about a specialized dict for FASTA? Shouldn't it increase ZSTD compression significantly?

    Using larger-than-default window sizes has the drawback of requiring that the same --long=xx argument be passed during decompression reducing compatibility somewhat.
Interesting. Any idea why this can't be stored in the metadata of the compressed file?
Nice observation!

Took me a while to realize that Grace Blackwell refers to a person and not an Nvidia chip :)

I’ve worked with large genomic datasets on my own dime, and the default formats show their limits quickly. With FASTA, the first step for me is usually conversion: unzip headers from sequences, store them in Arrow-like tapes for CPU/GPU processing, and persist as Parquet when needed. It’s straightforward, but surprisingly underused in bioinformatics — most pipelines stick to plain text even when modern data tooling would make things much easier :(

I've also noticed this. Zstandard doesn't see very common patterns

For me it was an increasing number (think of unix timestamps in a data logger that stores one entry per second, so you are just counting up until there's a gap in your data), in the article it's a fixed value every 60 bytes

Of course, our brains are exceedingly good at finding patterns (to the point where we often find phantom ones). I was just expecting some basic checks like "does it make sense to store the difference instead of the absolute value for some of these bytes here". Seeing as the difference is 0 between every 60th byte in the submitted article, that should fix both our issues

Bzip2 performed much better for me but it's also incredibly slow. If it were only the compressor, that might be fine for many applications, but also decompressing is an exercise in patience so I've moved to Zstandard at the standard thing to use

FASTA is a candidate for the stupidest file format ever invented and a testament to the massive gap in perceived vs actual programming ability of the average bioinformatician.
It might be the stupidest, but stupid in the sense of "the simplest thing that could possibly work."

When FASTA was invented, Sanger sequencing reads would be around a thousand bases in length. Even back then, disk space wasn't so precious that you couldn't spend several kilobytes on the results of your experiment. Plus, being able to view your results with `more` is a useful feature when you're working with data of that size.

And, despite its simplicity, it has worked for forty years.

I think the prevalence of the format vs something more widely used should be part of that metric.

On those grounds, the lack of pre-tokenization in html/css/js ranks at this point as a planet killing level of poor choices.

The FASTA format looks like:

    > title
    bases with optional newlines
    > title
    bases with optional newlines
    ...
The author is talking about removing the non-semantic optional newlines (hard wrapping), not all the newlines in the file.

It makes a lot of sense that this would work: bacteria have many subsequences in common, but if you insert non-semantic newlines at effectively random offsets then compression tools will not be able to use the repetition effectively.

this is also the insight that the bwa developer had, to use the burrows-wheeler transform which is part of bzip2 due to it's compression properties being particularly good for genomic sequences.
In case "bases with optional newlines" wasn't obvious to anyone else, a specific example (from Wikipedia) is:

    ;LCBO - Prolactin precursor - Bovine
    MDSKGSSQKGSRLLLLLVVSNLLLCQGVVSTPVCPNGPGNCQVSLRDLFDRAVMVSHYIHDLSS
    EMFNEFDKRYAQGKGFITMALNSCHTSSLPTPEDKEQAQQTHHEVLMSLILGLLRSWNDPLYHL
    VTEVRGMKGAPDAILSRAIEIEEENKRLLEGMEMIFGQVIPGAKETEPYPVWSGLPSLQTKDED
    ARYSAFYNLLHCLRRDSSKIDTYLKLLNCRIIYNNNC*
where "SS...EM", HL..VT", or "ED..AR" may be common subsequences, but the plaintext file arbitrarily wraps at column 65 so it renders on a DEC VT100 terminal from the 70s nicely.

Or, for an even simpler example:

    ; plaintext
    GATTAC
    AGATTA
    CAGATT
    ACCAGA
    TTACAG
    ATTACA
becomes, on disk, something like

    ; plaintext\r\nGATTAC\r\nAGATTA\r\nCAGATT\r\nACCAGA\r\nTTACAG\r\nATTACA\r\n
which is hard to compress, while

    ; plaintext\r\nGATTACAGATTACAGATTACCAGATTACAGATTACA
is just

    "; plaintext\r\n" + "GATTACA" * 7
and then, if you want, you can reflow the text when it's time to render to the screen.
When working with data, I definitely prefer the UI to adapt to the data. I never save anything for the display back.
Damn surely you stop using ASCII formats before your dataset gets to 2 TB??
(comment deleted)
Looking forward to the relegation of FASTQ and FASTA to the depths of hell where they belong. Incredibly inefficient and poorly designed formats.
How can we represent data or algos such that such optimisations before more obvious?
When you know you're going to be compressing files of particular structure, it's often very beneficial to tweak compression algorithm parameters. In one case when dealing with CSV data, I was able to find a LZMA2 compression level, dictionary size and compression mode that yielded a massive speedup, uses 1/100th the memory and surprisingly even yields better compression ratios, probably from the smaller dictionary size. That's in comparison to the library's default settings.
Could you please provide more details, perhaps give an example?
Removing the wrapping newline from the FASTA/FASTQ convention also dramatically improves parsing perf when you don't have to do as much lookahead to find record ends.
> I speculated that this poor performance might be caused by the newline bytes (0x0A) punctuating every 60 characters of sequence, breaking the hashes used for long range pattern matching.

If the linefeeds were treated as semantic characters and not allowed to break the hash size, you would get similar results without pre-filtering and post-filtering. It occurs to me that this strategy is so obvious that there must be some reason it won't work.

What's current way to accessibly process my 23andme raw data ? It's been synthesized decade ago and SNPedia and Promethease seems abandoned, so what's alternative if there is, and if there is none how we arrived to this?
I was no longer on the scene when it happened, but I’ve been told it became very difficult to get ongoing funding from the National Science Foundation for bioinformatics software around 10 years ago. You could get an initial grant to develop something, but ongoing support was difficult. So websites and ‘databases’ (curated datasets) that made it easy to run the tools faded away.
What format is the 23andMe data in, by the way?
tab delimited file (usually compressed for distribution), containing the fields rsid, chromosome, position, genotype (e.g. rs3094315 1 742429 AG).
I've explored alternatives to FASTA and FASTQ but in most cases I found that simply not storing sequence data is the best option of all, but if I have to do it, columnar formats with compression are usually the best alternative when considering all of (my) the constraints.
This is because Zstd's long-distance matcher looks for matching sequences of 64 bytes [0]. Because long matching sequences of the data will likely have the newlines inserted in different offsets in the run, this totally breaks Zstd's ability to find the long-distance match.

Ultimately, Zstd is a byte-oriented compressor that doesn't understand the semantics of the data it compresses. Improvements are certainly possible if you can recognize and separate that framing to recover a contiguous view of the underlying data.

[0] https://github.com/facebook/zstd/blob/v1.5.7/lib/compress/zs...

(I am one of the maintainers of Zstd.)

To me the most interesting thing here isn't that you can compress something better by removing randomly-distributed semantically-meaningless information. It's why zstd --long does so much better than gzip when you do and the default does worse than gzip.

What lessons can we take from this?

There's some discussion here about DNA-specific compression algorithms.

I thought I'd raise yesterday's HN discussion on 'The unreasonable effectiveness of modern sort algorithms' https://news.ycombinator.com/item?id=45208828

That blog post isn't about DNA per se, but it is about sorting data when you know there are only 4 numbers. I guess DNA has 5 - A,T,G,C,N the unknown base - but there's a huge space of DNA-specific compression research that outperforms ZSTD.